PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv4_096120_faoj.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family EIL
Protein Properties Length: 698aa    MW: 77321.5 Da    PI: 5.4505
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv4_096120_faoj.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3520.76.2e-159504331353
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                         +el++rmw+d+mllk+lke++k++   ke  ++a+k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+L
  Bv4_096120_faoj.t1  50 DELERRMWRDRMLLKKLKEQSKDKA--KEG-VDAAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNL 137
                         79*********************65..888.************************************************************ PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHH CS
                EIN3  92 raWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwg 182
                         raWWkekv+fdrngpaai+kyqa++ i++ ++++++   s++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWPtG e+ww+
  Bv4_096120_faoj.t1 138 RAWWKEKVRFDRNGPAAIAKYQADHSIPGINEDCNA-MASTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPTGIEEWWP 227
                         **********************************88.99**************************************************** PP

                         HHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XXXXXXXX CS
                EIN3 183 elglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ssslrkqs 271
                         +lgl+kdqg+ppykkphdlkkawkvsvLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee++++++ ++  ++    +s
  Bv4_096120_faoj.t1 228 QLGLPKDQGAPPYKKPHDLKKAWKVSVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEALARRLFPDrcPPPNAGGS 318
                         *********************************************************************************87667788** PP

                         XXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX..................................XXXXXXXXXXXXXXXXXXXXX..... CS
                EIN3 272 pkvtlsceqkedvegkkeskikhvqavktta..................................gfpvvrkrkkkpsesakvsskevsrt 328
                          ++++s+++++dveg +    ++v  +k ++                                  + ++ +krk+++s s  v+++++   
  Bv4_096120_faoj.t1 319 GSLVISDSSDYDVEGVDTDPNSEVDDNKPQNinlfnfgvgaerekfmtpnpmltsaikgevidanTSEFSEKRKQPSSGSHLVMDQKI-FV 408
                         **************766666699999999999********************************9999******99999999999986.** PP

                         .XXXXXXX.XXXXXXXXXXXXXXXX CS
                EIN3 329 cqssqfrgsetelifadknsisqne 353
                         c+  q+++s+++l+f d+ns+++++
  Bv4_096120_faoj.t1 409 CEYPQCPYSDSRLGFLDRNSRNNHQ 433
                         ***********************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048739.1E-13250299No hitNo description
Gene3DG3DSA:1.10.3180.102.2E-75172309IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.96E-61178302IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    Send to blast
MGYFEDMGFC SNFDFFAPPP SMAGEGEVGR EAEAEAAVDE EYSDDEVDVD ELERRMWRDR  60
MLLKKLKEQS KDKAKEGVDA AKQRQSQEQA RRKKMSRAQD GILKYMLKMM EVCKAQGFVY  120
GIIPEKGKPV SGASDNLRAW WKEKVRFDRN GPAAIAKYQA DHSIPGINED CNAMASTPHT  180
LQELQDTTLG SLLSALMQHC DPPQRRFPLE KGVPPPWWPT GIEEWWPQLG LPKDQGAPPY  240
KKPHDLKKAW KVSVLTAVIK HMSPDIAKIR KLVRQSKCLQ DKMTAKESAT WLAIINQEEA  300
LARRLFPDRC PPPNAGGSGS LVISDSSDYD VEGVDTDPNS EVDDNKPQNI NLFNFGVGAE  360
REKFMTPNPM LTSAIKGEVI DANTSEFSEK RKQPSSGSHL VMDQKIFVCE YPQCPYSDSR  420
LGFLDRNSRN NHQLNCAYRF SPSTHGVGAT NFQGNSIEAA NFPTSFAQPE KLSLQSENQS  480
STTFSTSGLG LPEDGQKLIT NLMSVYDNTL HQNKNVNLGS GNFAENNQIG GGFACQQGAL  540
FGNSASQGMN INTMKDHNQA QPKVSQFQLD NGFLGQGMPM NVNNNPQQKL QFQMGSSVFQ  600
GTNMNPPEQK VQLAMDTSFN GQRTVSGANV VTQGTNMSGS VFQSNAIQLD HGRAFDSSSF  660
GMTLNDNMSD FGFGGVPFNL STIDFDQLSR QDNSIWNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A3e-831763081133Protein ETHYLENE INSENSITIVE 3
4zds_B3e-831763081133Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010694878.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0J8E4K40.0A0A0J8E4K4_BETVU; Uncharacterized protein
STRINGVIT_13s0047g00250.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein